PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G0440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 314aa    MW: 34184.5 Da    PI: 8.3165
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G0440genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding621.2e-191661147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ll ++v+++G+++W++I++ ++ gR++k+c++rw + 
      Gh_A11G0440 16 KGPWSPEEDDLLQKLVQKYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 61
                     79******************************.***********985 PP

2Myb_DNA-binding57.33.6e-1870112347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde +++a++++G++ W+tIar ++ gRt++ +k++w++ 
      Gh_A11G0440  70 AFTPEEDETIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 112
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.2551166IPR017930Myb domain
SuperFamilySSF466891.58E-3213109IPR009057Homeodomain-like
SMARTSM007177.2E-181564IPR001005SANT/Myb domain
PfamPF002491.5E-191661IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-261769IPR009057Homeodomain-like
CDDcd001675.28E-171860No hitNo description
SMARTSM007173.8E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129421.46768117IPR017930Myb domain
CDDcd001671.58E-1270113No hitNo description
PfamPF002491.2E-1570112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2370116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAVTSTSNRK EMDRIKGPWS PEEDDLLQKL VQKYGPRNWS LISKSIPGRS GKSCRLRWCN  60
QLSPQVEHRA FTPEEDETII RAHARFGNKW ATIARLLNGR TDNAIKNHWN STLKRKCLSV  120
GEESNFITHG GYDGNLGGEG KQQPLKRSVS AGLYMSPGSP SGSDLSDSSV PVLSSSHVYK  180
PIPRTGGVSV DVNVMPLPGV EAAASSSNDP PTSLSLSLPG AESYELSVST LPVTESTQTR  240
NEAKNDGKGG EVMGFSAEFM AVMQEMIRME VRDYMVQMQQ QNGGVSRGEG MGMCLDAGFR  300
NVLSMSRVGV NKID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-42151173105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-42151173105C-Myb DNA-Binding Domain
1msf_C2e-42151173105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.92090.0boll| ovule| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591221e-70AJ459122.1 Gossypium hirsutum partial myb104b gene, clone pGhMYB104b.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489200.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-102MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2T9E30.0A0A0D2T9E3_G
STRINGPOPTR_0007s10490.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-101myb domain protein 73